CDS

Accession Number TCMCG067C27335
gbkey CDS
Protein Id KAF8091747.1
Location join(28046..28117,28320..28388,28828..28921,29054..29130)
Organism Sinapis alba
locus_tag N665_0436s0010

Protein

Length 103aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA214277, BioSample:SAMN02744833
db_source MU105986.1
Definition hypothetical protein N665_0436s0010 [Sinapis alba]
Locus_tag N665_0436s0010

EGGNOG-MAPPER Annotation

COG_category U
Description Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding
KEGG_TC 3.A.5.9
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko02044        [VIEW IN KEGG]
KEGG_ko ko:K03109        [VIEW IN KEGG]
EC -
KEGG_Pathway ko03060        [VIEW IN KEGG]
map03060        [VIEW IN KEGG]
GOs GO:0003674        [VIEW IN EMBL-EBI]
GO:0005047        [VIEW IN EMBL-EBI]
GO:0005488        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005783        [VIEW IN EMBL-EBI]
GO:0005785        [VIEW IN EMBL-EBI]
GO:0005786        [VIEW IN EMBL-EBI]
GO:0005789        [VIEW IN EMBL-EBI]
GO:0005791        [VIEW IN EMBL-EBI]
GO:0006605        [VIEW IN EMBL-EBI]
GO:0006612        [VIEW IN EMBL-EBI]
GO:0006613        [VIEW IN EMBL-EBI]
GO:0006614        [VIEW IN EMBL-EBI]
GO:0006616        [VIEW IN EMBL-EBI]
GO:0006810        [VIEW IN EMBL-EBI]
GO:0006886        [VIEW IN EMBL-EBI]
GO:0008104        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0012505        [VIEW IN EMBL-EBI]
GO:0015031        [VIEW IN EMBL-EBI]
GO:0015833        [VIEW IN EMBL-EBI]
GO:0016020        [VIEW IN EMBL-EBI]
GO:0030867        [VIEW IN EMBL-EBI]
GO:0031090        [VIEW IN EMBL-EBI]
GO:0031984        [VIEW IN EMBL-EBI]
GO:0032991        [VIEW IN EMBL-EBI]
GO:0033036        [VIEW IN EMBL-EBI]
GO:0033365        [VIEW IN EMBL-EBI]
GO:0034613        [VIEW IN EMBL-EBI]
GO:0042175        [VIEW IN EMBL-EBI]
GO:0042886        [VIEW IN EMBL-EBI]
GO:0043021        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044425        [VIEW IN EMBL-EBI]
GO:0044432        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0044877        [VIEW IN EMBL-EBI]
GO:0045047        [VIEW IN EMBL-EBI]
GO:0045184        [VIEW IN EMBL-EBI]
GO:0046907        [VIEW IN EMBL-EBI]
GO:0048500        [VIEW IN EMBL-EBI]
GO:0051179        [VIEW IN EMBL-EBI]
GO:0051234        [VIEW IN EMBL-EBI]
GO:0051641        [VIEW IN EMBL-EBI]
GO:0051649        [VIEW IN EMBL-EBI]
GO:0055085        [VIEW IN EMBL-EBI]
GO:0065002        [VIEW IN EMBL-EBI]
GO:0070727        [VIEW IN EMBL-EBI]
GO:0070972        [VIEW IN EMBL-EBI]
GO:0071702        [VIEW IN EMBL-EBI]
GO:0071705        [VIEW IN EMBL-EBI]
GO:0071806        [VIEW IN EMBL-EBI]
GO:0072594        [VIEW IN EMBL-EBI]
GO:0072599        [VIEW IN EMBL-EBI]
GO:0072657        [VIEW IN EMBL-EBI]
GO:0090150        [VIEW IN EMBL-EBI]
GO:0098588        [VIEW IN EMBL-EBI]
GO:0098796        [VIEW IN EMBL-EBI]
GO:0098827        [VIEW IN EMBL-EBI]
GO:1990904        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGGTTTACATAGTTTCATGGGACGAGTTCGTAGATCGATCTGTTCAGCTTTTCAAAGCTGATCCCGAATCTACTAGGTATGTTGTCAAGTATAGACATTGTGATGGCAAGTTGGTTCTCAAGGTTACTGATAACAAAGAGTGTCTCAAGTTCAAGACAGACCAAGCACAAGAAGCAAAGAAGATGGAGAAACTGAATAACATATTCTTTACCCTCATGGCCAGAGGACCTGATGTTGATCTTTCTGAAGTGAACGGGAAAGAACAGATGGAAACACAACCTATGAAGAAAGGAAGAGGAAGGAAGCAATAA
Protein:  
MVYIVSWDEFVDRSVQLFKADPESTRYVVKYRHCDGKLVLKVTDNKECLKFKTDQAQEAKKMEKLNNIFFTLMARGPDVDLSEVNGKEQMETQPMKKGRGRKQ